PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TALE
Protein Properties Length: 562aa    MW: 63973.3 Da    PI: 6.8203
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004433genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-084805181854
                  HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  DCAR_004433 480 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 518
                  5887779******************************88 PP

2BELL64.22.8e-21355420471
         BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                  e++ +k  Ll+ll++Vd++Y+++ ++++ vis+F+ v++l++ ++++++Al+++   +++L+++i++ 
  DCAR_004433 355 EVETRK-NLLDLLQMVDNQYNHCLDEIHKVISAFHSVTELDP-HIHAHFALQTVDMLYKNLRERISKS 420
                  566666.5**********************************.**********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.4E-15277419IPR006563POX domain
PfamPF075261.9E-21283418IPR006563POX domain
PROSITE profilePS5007110.965459522IPR001356Homeobox domain
SMARTSM003892.3E-5462526IPR001356Homeobox domain
CDDcd000863.41E-10462523No hitNo description
SuperFamilySSF466892.8E-15464531IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-26465528IPR009057Homeodomain-like
PfamPF059208.9E-15479518IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MDSFTVPTNM DCPNHIIEED KFLCSTSISG YQSNLHNLNE QSQIMAEFPA LCLTQGEFLN  60
HLQWHPHLNY HGEIPSYTAF TSRSSQQERV PDSTGRLYPT SNTENQVKYM GGMATFGAAH  120
ANLANFNGKE TPPACAQEVM KPFVSNDYDT GRSSLGTFGN HEERNVNVRS KRDSHNNLAP  180
QFARPVPEIT EFEPLITMGN MDQNGWVSAE NRSMSSDYTS GSSKYSNELS PSLSVSQPAA  240
IRTITFPEHC SEISGSGSEQ ASCNISNFSP NLSYQPVQLS SLLSGSRFLT GLQEILSELA  300
TYCFKNSGRV GYFAGRTSSR INIPHASSQD AERSYTPMDP DSSNDDNYLP TRGQEVETRK  360
NLLDLLQMVD NQYNHCLDEI HKVISAFHSV TELDPHIHAH FALQTVDMLY KNLRERISKS  420
VLALGARLHD GSRKEEEMPF ETSFIQKQWA LQQLRRKEHQ LWRPQRGLPE RSVSVLRAWM  480
FQNFLHPYPK DAEKHLLAVK SGLTRSQVSN WFINARVRIW KPMIDEMYSE MNRRKRHQNN  540
EEIDSHQRNH ISIDGHRFRM F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15468526563Homeobox protein Meis2
3k2a_B2e-15468526563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotP487311e-100ATH1_ARATH; Homeobox protein ATH1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-100homeobox gene 1